PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D10G0251
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 154aa    MW: 16965 Da    PI: 7.4258
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D10G0251genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP76.54.3e-2456103148
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 
                  +Cqve+C+ad+++ak+yhrrhkvCe+h+kapvv v+g++qrfCqqCs 
  Gh_D10G0251  56 ACQVENCTADMTDAKRYHRRHKVCEFHAKAPVVRVAGIHQRFCQQCSS 103
                  5*********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.6E-2352104IPR004333Transcription factor, SBP-box
PROSITE profilePS5114117.1154131IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.44E-2355104IPR004333Transcription factor, SBP-box
PfamPF031101.4E-1957106IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 154 aa     Download sequence    Send to blast
MATSKAEGKR RLKEMAEEEE EEEEEDEDNS TTGDDDKKKK GKRGSSTVVG GSCLPACQVE  60
NCTADMTDAK RYHRRHKVCE FHAKAPVVRV AGIHQRFCQQ CSSIQTGDAN AGSMSYQSLM  120
KQKGAVDGVW PDTTSAVGKV HRNIMEKAQI IKTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-1950105459squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.137811e-159boll
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN7951321e-154JN795132.1 Gossypium hirsutum SPL3 mRNA, complete cds.
GenBankKJ6223111e-154KJ622311.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012455582.12e-46PREDICTED: squamosa promoter-binding-like protein 3
SwissprotQ387418e-32SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLA0A0D2RE062e-46A0A0D2RE06_G
TrEMBLA0A0D2SZ405e-46A0A0D2SZ40_G
STRINGSolyc02g077920.2.11e-27(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM3546022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.17e-25squamosa promoter binding protein-like 3